Loading...
Statistics
Advertisement

The Cold Hard Truth: On Sports -
www.thechtonsports.com/

Thechtonsports.com

Advertisement
Conversion Technology Metas Server
Thechtonsports.com is hosted in United States / Provo . Thechtonsports.com uses HTTPS protocol. Number of used technologies: 11. First technologies: CSS, Flexslider, Google Font API, Number of used javascripts: 26. First javascripts: Batch.js, Jquery.js, Jquery-migrate.min.js, Number of used analytics tools: 3. First analytics tools: Google AdWords Conversion Tracking, Google Remarketing, WordPress Stats, Number of used plugins, modules: 11. Its server type is: nginx/1.10.1. Its CMS is: Wordpress.

Technologies in use by Thechtonsports.com

Technology

Number of occurences: 11
  • CSS
  • Flexslider
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Iframe
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 26
  • batch.js
  • jquery.js
  • jquery-migrate.min.js
  • flags.js
  • toolbar.js
  • load-toolbar.js
  • wpp-popup-frontend.js
  • external-tracking.min.js
  • element.js
  • photon.js
  • polls-js.js
  • devicepx-jetpack.js
  • gprofiles.js
  • wpgroho.js
  • jquery.flexslider.js
  • jquery.elastislide.js
  • scripts.js
  • ticker.js
  • respond.min.js
  • jquery.isotope.min.js
  • jquery.imagesloaded.min.js
  • css3-mediaqueries.js
  • retina.js
  • wp-embed.min.js
  • e-201635.js
  • conversion.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 3
  • Google AdWords Conversion Tracking
  • Google Remarketing
  • WordPress Stats

Advertise

Number of occurences: 1
  • DoubleClick.Net

Server Type

  • nginx/1.10.1

Social

Number of occurences: 4
  • Facebook Like box
  • Facebook Box
  • Google +1 Button
  • Twitter Button

Used plugins, modules

Number of plugins and modules: 11
  • batchmove
  • google language translator
  • m wp popup
  • google analyticator
  • jetpack
  • wp polls
  • social polls by opinionstage
  • wysija newsletters
  • wp social seo booster
  • photon
  • wpgroho.js?ver=4.5.3 http:

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Thechtonsports.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by BlueHost.Com, INC/OU=PositiveSSL Wildcard/CN=*.bluehost.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by BlueHost.Com, INC
        • 2: PositiveSSL Wildcard
      • CN: *.bluehost.com
    • hash: b00471fb
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 275919344465328667035358918366332841359
    • validFrom: 150313000000Z
    • validTo: 180312235959Z
    • validFrom_time_t: 1426204800
    • validTo_time_t: 1520899199
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 29:B6:2F:A5:A8:41:C7:45:BE:86:84:10:E9:26:A7:94:67:64:BC:73
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.bluehost.com, DNS:bluehost.com

Meta - Thechtonsports.com

Number of occurences: 13
  • Name:
    Content: article
  • Name: viewport
    Content: width=device-width, initial-scale=1, maximum-scale=1
  • Name: robots
    Content: noodp
  • Name: twitter:card
    Content: summary_large_image
  • Name: twitter:title
    Content: The Cold Hard Truth: On Sports -
  • Name: twitter:site
    Content: @TheCHTOnSports
  • Name: twitter:image
    Content: http://thechtonsports.com/wp-content/uploads/2016/06/12391132_1241121402581737_891064399056240767_n.jpg
  • Name: msvalidate.01
    Content: 1873EBC79F9C224FC6F2661F8933DA9B
  • Name: google-site-verification
    Content: AGhA43C5kBGvktv9LTklZTSBw_zdltfSIENxI3JDUJE
  • Name: p:domain_verify
    Content: 2d3778fcfc878581dedf17ce069024ea
  • Name: yandex-verification
    Content: 7200725602db5dae
  • Name: generator
    Content: WordPress 4.5.3
  • Name: msapplication-TileImage
    Content: http://i2.wp.com/thechtonsports.com/wp-content/uploads/2015/12/cropped-CHT-Logo-360x360.png?fit=270%2C270

Server / Hosting

  • IP: 66.147.244.98
  • Latitude: 40.22
  • Longitude: -111.61
  • Country: United States
  • City: Provo

Rname

  • ns1.bluehost.com
  • ns2.bluehost.com
  • mail.thechtonsports.com

Target

  • root.box798.bluehost.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx/1.10.1 Date: Fri, 02 Sep 2016 12:34:50 GMT Content-Type: text/html; charset=UTF-8 Content-Length: 0 Location: http://thechtonsports.com/ Vary: Accept-Encoding X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Fri, 02 Sep 2016 12:34:53 GMT Content-Type: text/html; charset=UTF-8 Link: ; rel="https://api.w.org/", ; rel=shortlink Vary: Accept-Encoding X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

DNS

host: thechtonsports.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 66.147.244.98
host: thechtonsports.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.bluehost.com
host: thechtonsports.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.bluehost.com
host: thechtonsports.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.bluehost.com
  5. rname: root.box798.bluehost.com
  6. serial: 2014080402
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 300
host: thechtonsports.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mail.thechtonsports.com
host: thechtonsports.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx ptr include:bluehost.com ?all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hechtonsports.com, www.tqhechtonsports.com, www.qhechtonsports.com, www.tahechtonsports.com, www.ahechtonsports.com, www.t hechtonsports.com, www. hechtonsports.com, www.twhechtonsports.com, www.whechtonsports.com, www.tehechtonsports.com, www.ehechtonsports.com, www.tzhechtonsports.com, www.zhechtonsports.com, www.txhechtonsports.com, www.xhechtonsports.com, www.tchechtonsports.com, www.chechtonsports.com, www.techtonsports.com, www.theechtonsports.com, www.teechtonsports.com, www.thdechtonsports.com, www.tdechtonsports.com, www.thcechtonsports.com, www.tcechtonsports.com, www.thuechtonsports.com, www.tuechtonsports.com, www.thjechtonsports.com, www.tjechtonsports.com, www.thechtonsports.com, www.techtonsports.com, www.thbechtonsports.com, www.tbechtonsports.com, www.thgechtonsports.com, www.tgechtonsports.com, www.thchtonsports.com, www.thexchtonsports.com, www.thxchtonsports.com, www.theschtonsports.com, www.thschtonsports.com, www.thewchtonsports.com, www.thwchtonsports.com, www.therchtonsports.com, www.thrchtonsports.com, www.thefchtonsports.com, www.thfchtonsports.com, www.thevchtonsports.com, www.thvchtonsports.com, www.thecchtonsports.com, www.thcchtonsports.com, www.theqchtonsports.com, www.thqchtonsports.com, www.theachtonsports.com, www.thachtonsports.com, www.theychtonsports.com, www.thychtonsports.com, www.thehtonsports.com, www.thecdhtonsports.com, www.thedhtonsports.com, www.thecrhtonsports.com, www.therhtonsports.com, www.thecthtonsports.com, www.thethtonsports.com, www.thecvhtonsports.com, www.thevhtonsports.com, www.thecfhtonsports.com, www.thefhtonsports.com, www.thecghtonsports.com, www.theghtonsports.com, www.thechhtonsports.com, www.thehhtonsports.com, www.thecnhtonsports.com, www.thenhtonsports.com, www.thecmhtonsports.com, www.themhtonsports.com, www.thecjhtonsports.com, www.thejhtonsports.com, www.thectonsports.com, www.thechetonsports.com, www.thecetonsports.com, www.thechdtonsports.com, www.thecdtonsports.com, www.thechctonsports.com, www.thecctonsports.com, www.thechutonsports.com, www.thecutonsports.com, www.thechjtonsports.com, www.thecjtonsports.com, www.thechtonsports.com, www.thectonsports.com, www.thechbtonsports.com, www.thecbtonsports.com, www.thechgtonsports.com, www.thecgtonsports.com, www.thechonsports.com, www.thechtqonsports.com, www.thechqonsports.com, www.thechtaonsports.com, www.thechaonsports.com, www.thecht onsports.com, www.thech onsports.com, www.thechtwonsports.com, www.thechwonsports.com, www.thechteonsports.com, www.thecheonsports.com, www.thechtzonsports.com, www.thechzonsports.com, www.thechtxonsports.com, www.thechxonsports.com, www.thechtconsports.com, www.thechconsports.com, www.thechtnsports.com, www.thechtobnsports.com, www.thechtbnsports.com, www.thechtohnsports.com, www.thechthnsports.com, www.thechtognsports.com, www.thechtgnsports.com, www.thechtojnsports.com, www.thechtjnsports.com, www.thechtomnsports.com, www.thechtmnsports.com, www.thechto nsports.com, www.thecht nsports.com, www.thechtovnsports.com, www.thechtvnsports.com, www.thechtosports.com, www.thechtonnsports.com, www.thechtonsports.com, www.thechtonhsports.com, www.thechtohsports.com, www.thechtonjsports.com, www.thechtojsports.com, www.thechtonksports.com, www.thechtoksports.com, www.thechtonlsports.com, www.thechtolsports.com, www.thechton sports.com, www.thechto sports.com, www.thechtonports.com, www.thechtonseports.com, www.thechtoneports.com, www.thechtonswports.com, www.thechtonwports.com, www.thechtonsdports.com, www.thechtondports.com, www.thechtonsxports.com, www.thechtonxports.com, www.thechtonsfports.com, www.thechtonfports.com, www.thechtonsgports.com, www.thechtongports.com, www.thechtonstports.com, www.thechtontports.com, www.thechtonsorts.com, www.thechtonspiorts.com, www.thechtonsiorts.com, www.thechtonspkorts.com, www.thechtonskorts.com, www.thechtonspuorts.com, www.thechtonsuorts.com, www.thechtonspjorts.com, www.thechtonsjorts.com, www.thechtonsplorts.com, www.thechtonslorts.com,

Other websites we recently analyzed

  1. Welcome to Gehlin.Com!
    Sweden - 213.180.93.13
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Html
    Number of meta tags: 1
  2. tampacriminaldefenselawyer.net
    Wayne (United States) - 216.250.120.114
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  3. 267286.com
    China - 203.195.130.175
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Html5, Iframe, Javascript
    Number of meta tags: 1
  4. Exotic Beads Manufacturer Penang, Georgetown, Ethnic Beads Supplier Malaysia ~ Guo Qiang Sdn Bhd (beadsZONE)
    Guo Qiang Sdn Bhd (beadsZONE) is the largest manufacturer and supplier of ethnic & exotic beads accessories and jewellery in Penang, Malaysia.
    Malaysia - 119.110.102.139
    G Analytics ID: UA-37858188-33
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Javascript, jQuery UI, Php, Google Analytics, Facebook Box
    Number of Javascript: 6
    Number of meta tags: 9
  5. Concern Organization
    Concern Organization is a nongovernmental, nonprofit and nonpolitical organization based in Faisalabad in the province of Punjab – Pakistan. We mainly work
    Houston (United States) - 192.185.46.37
    Server software: nginx/1.10.1
    Technology: CSS, Fancybox, Flexslider, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Lightbox, Php, Pingback, Shortcodes, SuperFish, Wordpress
    Number of Javascript: 22
    Number of meta tags: 4
  6. Le Moulin du Vey
    Location de gîtes en Normandie, de chambres d'hôtes en Normandie, Location de salle de Réception en Normandie, au coeur de la Suisse-Normande à Clécy.
    Mountain View (United States) - 74.125.140.121
    Server software: Varnish
    Technology: CSS, Html, Iframe, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 3
  7. The MAV Agency: Social Media Management
    The MAV Agency brings a new perspective to social media management by focusing on engagement and building a community among your followers.
    Ashburn (United States) - 54.83.179.144
    Server software: Pepyaka/1.9.13
    Technology: CSS, Html, Html5, Javascript, Wix
    Number of Javascript: 2
    Number of meta tags: 7
  8. jadhav.com
    Road Town (Virgin Islands, British) - 208.91.197.127
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  9. Damitra Indopadma
    Kitchen Specialist and IT Consultan
    Jakarta (Indonesia) - 103.229.72.46
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Html5, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 3
  10. Rose Jackson-Beavers | Author • Workshop Presenter • Publisher
    Scottsdale (United States) - 23.229.159.195
    Server software: Apache/2.4.23
    Technology: CSS, Datepicker, Fancybox, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SuperFish, Wordpress
    Number of Javascript: 15
    Number of meta tags: 3

Check Other Websites